PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID DCAR_026359
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Apiales; Apiineae; Apiaceae; Apioideae; Scandiceae; Daucinae; Daucus
Family SBP
Protein Properties Length: 1086aa    MW: 119741 Da    PI: 7.9998
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
DCAR_026359genomeARS-USDAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP129.61.2e-40167243278
                  -SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
          SBP   2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                  Cqv++C++dls+ak+yhrrhkvCevhska++++v +++qrfCqqCsrfh lsefDe+krsCrrrLa+hn+rrrk+q+
  DCAR_026359 167 CQVDDCKEDLSTAKDYHRRHKVCEVHSKATKAIVGKQMQRFCQQCSRFHPLSEFDEGKRSCRRRLAGHNRRRRKTQP 243
                  **************************************************************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.106.0E-34161228IPR004333Transcription factor, SBP-box
PROSITE profilePS5114131.975164241IPR004333Transcription factor, SBP-box
SuperFamilySSF1036123.53E-37165245IPR004333Transcription factor, SBP-box
PfamPF031104.2E-30167240IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1086 aa     Download sequence    Send to blast
MEEVGTQVAS SHYIHQSLSK HFLDSQHHPM AAAKKRSMPF HPLGFHLPQS QQQQPMFGSG  60
FQQSRGQWHP NGWDWDSAKF LAKPVESDVI RGGPSTMSVQ SVMQRGHGDE IIAANSVDLR  120
GNHVVEDDEN LLLKLGGSRV NSAEENVLRP NKKVRSGSPA GGNYPKCQVD DCKEDLSTAK  180
DYHRRHKVCE VHSKATKAIV GKQMQRFCQQ CSRFHPLSEF DEGKRSCRRR LAGHNRRRRK  240
TQPDDVTSKL LPPTNRENVS NGDVDLVNIL AILARAQGNT EDGSINGSSI PNKDQLIQIL  300
QKINALPLPA DFSAKFPPSG VTSNIAPFQS ESENKLNGNN SHSSTLDLLA VLSGNQAGSS  360
PDATAVPSRR SSHGSDSEKT RSPCTNMQTR HQNEFASVGE RSSTSYQSPT ECSDGQVQEI  420
RTNLPLQLFS SSPESDSPPK LASSTKYFSS GSSNPMEERS PSSSPPFVQK LFPTVFSREA  480
VNPKRLLNRL EFNGSSKAGK DKGCSTSLDL FGGMNKCVDD SSVQSFPYQA GYTSSSGSDH  540
SPSSLNSDAQ NRSGRIYFKL IDRDPSQLPG KLRTQIFNWL GQSPSEMESY IRPGCVVLSI  600
YISMPSSAWE QLEDNLLQNI TSLVKDSEDP FWRKGRFLIN AGRQLASYQD GKAHLRKATR  660
AWSFPEVVSV SPLAVVGGQE TTILLKGRNL SDQYTKVFCT HAVGYKLEET SGSASDDTTY  720
DSITLHNFTV ADEAPGVLGR CFIEVENGFR GTSFPIIIAN ATICKELNLL ESAFDKVAAP  780
RDAISEESFL DSGRPISRED VLHFLNELGW VLQRKRYMSM FEVPEYKLHR FKFLFIFSVE  840
HDFCALVKTL LDVLLEICLG RDELSRESLQ MLLEIHLLNR AVKMRSRKMV DLLINYFVPT  900
DSGKTYIFLP NLAGPGGITP LHLAACMSDA NSMVDTLTTD PLEIGLHGWD SLLDANGLSP  960
CAYAQMRNNH SYNALVARKL VDRKNGQVSV PVGDEIQEQS LIAGQIHQAS FQIRQGQRSC  1020
SKCAVGAARY NRKTSASQGL LHRPYIHSML AIAAVCVCVC LFLRGAPDIG LVAPFKWENL  1080
GYGAV*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A7e-30157240184squamosa promoter binding protein-like 4
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002273784.10.0PREDICTED: squamosa promoter-binding-like protein 14 isoform X2
SwissprotQ8RY950.0SPL14_ARATH; Squamosa promoter-binding-like protein 14
TrEMBLF6I6X10.0F6I6X1_VITVI; Putative uncharacterized protein
STRINGVIT_18s0122g00380.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA128871219
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G20980.10.0squamosa promoter binding protein-like 14